Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
KIAA0533; KIAA1907; LAMA5; LAMA5_HUMAN; Laminin alpha 5 chain; Laminin subunit alpha 5; Laminin subunit alpha-5; Laminin; alpha 5; Laminin-10 subunit alpha; Laminin-11 subunit alpha; Laminin-15 subunit alpha; RP11-157P1.6
Species
Homo sapiens (Human)
Expression Region
3401-3692aa
Target Protein Sequence
FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 3401-3692 form the expressed segment for recombinant Human LAMA5. This LAMA5 protein is theoretically predicted to have a molecular weight of 47.1 kDa. The LAMA5 protein was expressed in e.coli. The LAMA5 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant LAMA5 protein during the following stages.
Human laminin subunit alpha-5 (LAMA5) is a crucial component of laminin, a major glycoprotein in the extracellular matrix (ECM) that plays a fundamental role in cell adhesion, migration, and differentiation. LAMA5 is specifically associated with laminin-10/11, a heterotrimeric form of laminin. Its expression is widespread in various tissues, contributing to the structural integrity of the basement membrane. Through interactions with integrins and other ECM molecules, LAMA5 is involved in cellular processes such as tissue development, angiogenesis, and maintenance of tissue architecture. Dysregulation of LAMA5 expression has been implicated in diseases, including cancer and certain genetic disorders. Research on LAMA5 continues to uncover its multifaceted functions and potential implications in various pathologies.